Skip to content

Commit 6e3934b

Browse files
imran-siddiqueCopilotkevinkaylieaymenhmaidiwastakenharshnair75567-cloud
authored
fix!: standardize DID method to did:agentmesh across all SDKs (v3.2.0) + critic gap docs (#1170)
* feat(dotnet): add MCP security namespace — completes cross-language MCP parity * fix(ci): add path filters and concurrency; announce v3.1.0 release CI optimization: - Add paths-ignore for docs to 5 code-only workflows - Add paths filter to Link Check (only run on docs changes) - Add concurrency groups to 7 heavy workflows - Docs-only PRs drop from ~14 checks to ~4 README: - Add v3.1.0 release announcement callout - Add PyPI version badge - Update tutorial count to 31 Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: update SOC2 mapping for resolved kill switch and DeltaEngine gaps - Kill switch is no longer placeholder: now implements saga handoff with handoff_success_count tracking (kill_switch.py:69-178) - DeltaEngine verify_chain() is no longer a stub: now performs SHA-256 chain verification (delta.py:67-127) - Move both from Critical/High gaps to new 'Resolved' section - Update Processing Integrity coverage (2 of 4 defects, not 3 of 4) - Update evidence table with current line ranges Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(dotnet): add MCP security namespace with scanner, gateway, redactor, and sanitizer Add AgentGovernance.Mcp namespace implementing full MCP security parity with TypeScript and Rust SDKs: - McpSecurityScanner: tool poisoning, typosquatting, hidden instructions, rug pull, schema abuse, cross-server attack, and description injection detection - McpCredentialRedactor: regex-based redaction of API keys, bearer tokens, connection strings, and secret assignments - McpResponseSanitizer: response scanning for prompt injection tags, imperative phrasing, credential leakage, and exfiltration URLs - McpGateway: policy enforcement pipeline with deny/allow lists, payload sanitization, rate limiting, and human approval gates Includes 46 xUnit tests covering all threat categories. Updates SDK-FEATURE-MATRIX.md to flip .NET MCP Security from — to ✅. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: add Entra Agent ID bridge tutorial (Tutorial 31) (#10) * fix(pipeline): run NuGet ESRP signing on Windows agent (#1022) The EsrpCodeSigning@5 task constructs internal paths (batchSignPolicyFile, ciPolicyFile) using Windows-style backslashes. Running on ubuntu-latest produced garbled mixed paths like '/home/vsts/work/1/s/src\myapp\'. Changes: - Add per-job pool override: PublishNuGet runs on windows-latest - Convert FolderPath and all shell commands to Windows paths - Replace bash scripts with PowerShell for the Windows agent - PyPI and npm stages remain on ubuntu-latest (unchanged) - Add comment to delete orphaned ESRP_DOMAIN_TENANT_ID ADO variable Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: reland empty-merge changes from PRs #1017 and #1020 (#1125) PRs #1017 and #1020 were squash-merged as empty commits (0 file changes). This commit re-applies the intended documentation updates. From PR #1017 (critic gaps): - LIMITATIONS.md: add sections 7 (knowledge governance gap), 8 (credential persistence gap), 9 (initialization bypass risk) - LIMITATIONS.md: add knowledge governance and enforcement infra rows to 'What AGT Is Not' table - THREAT_MODEL.md: add knowledge flow and credential persistence to residual risks, add configuration bypass vectors table, remove stale '10/10' qualifier From PR #1020 (SOC2 resolved gaps): - soc2-mapping.md: mark kill switch as resolved (saga handoff implemented in kill_switch.py:69-178) - soc2-mapping.md: mark DeltaEngine verify_chain() as resolved (SHA-256 chain verification in delta.py:67-127) - soc2-mapping.md: add Resolved section to gaps summary, update Processing Integrity to 2 of 4 defects (was 3 of 4) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(dotnet): add MCP security namespace — completes cross-language MCP parity (#1021) * fix(ci): add path filters and concurrency; announce v3.1.0 release CI optimization: - Add paths-ignore for docs to 5 code-only workflows - Add paths filter to Link Check (only run on docs changes) - Add concurrency groups to 7 heavy workflows - Docs-only PRs drop from ~14 checks to ~4 README: - Add v3.1.0 release announcement callout - Add PyPI version badge - Update tutorial count to 31 * docs: update SOC2 mapping for resolved kill switch and DeltaEngine gaps - Kill switch is no longer placeholder: now implements saga handoff with handoff_success_count tracking (kill_switch.py:69-178) - DeltaEngine verify_chain() is no longer a stub: now performs SHA-256 chain verification (delta.py:67-127) - Move both from Critical/High gaps to new 'Resolved' section - Update Processing Integrity coverage (2 of 4 defects, not 3 of 4) - Update evidence table with current line ranges * feat(dotnet): add MCP security namespace with scanner, gateway, redactor, and sanitizer Add AgentGovernance.Mcp namespace implementing full MCP security parity with TypeScript and Rust SDKs: - McpSecurityScanner: tool poisoning, typosquatting, hidden instructions, rug pull, schema abuse, cross-server attack, and description injection detection - McpCredentialRedactor: regex-based redaction of API keys, bearer tokens, connection strings, and secret assignments - McpResponseSanitizer: response scanning for prompt injection tags, imperative phrasing, credential leakage, and exfiltration URLs - McpGateway: policy enforcement pipeline with deny/allow lists, payload sanitization, rate limiting, and human approval gates Includes 46 xUnit tests covering all threat categories. Updates SDK-FEATURE-MATRIX.md to flip .NET MCP Security from — to ✅. --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: address external critic gaps (#1025) * feat(dotnet): add kill switch and lifecycle management to .NET SDK (#5) - Add KillSwitch with arm/disarm, event history, and subscriber notifications - Add LifecycleManager with 8-state machine and validated transitions - Add 26 xUnit tests - Update README Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(rust): add execution rings and lifecycle management to Rust SDK (#6) * feat(dotnet): add kill switch and lifecycle management to .NET SDK - Add KillSwitch with arm/disarm, event history, and subscriber notifications - Add LifecycleManager with 8-state machine and validated transitions - Add comprehensive xUnit tests for both components (26 tests) - Update .NET SDK README with usage documentation Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(rust): add execution rings and lifecycle management to Rust SDK Add two new modules to the agentmesh Rust crate: - rings.rs: Four-level execution privilege ring model (Admin/Standard/ Restricted/Sandboxed) with per-agent assignment and per-ring action permissions, ported from the Python hypervisor enforcer. - lifecycle.rs: Eight-state agent lifecycle manager (Provisioning through Decommissioned) with validated state transitions and event history, matching the lifecycle model used across other SDK languages. Both modules include comprehensive unit tests and are re-exported from the crate root. README updated with API tables and usage examples. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(go): add MCP security, execution rings, and lifecycle management to Go SDK (#7) * feat(openshell): add governance skill package and runnable example (#942) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(go): add MCP security, execution rings, and lifecycle management to Go SDK - mcp.go: MCP security scanner detecting tool poisoning, typosquatting, hidden instructions (zero-width chars, homoglyphs), and rug pulls - rings.go: Execution privilege ring model (Admin/Standard/Restricted/Sandboxed) with default-deny access control - lifecycle.go: Eight-state agent lifecycle manager with validated transitions - Full test coverage for all three modules - Updated README with API docs and examples Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: sync audit redaction status and framing with current code (#8) * feat(openshell): add governance skill package and runnable example (#942) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(typescript): add MCP security scanner and lifecycle management to TS SDK (#947) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: update SDK feature matrix after parity pass (#950) Reflects new capabilities added in PRs #947 (TS), .NET, Rust, Go: - TypeScript: MCP security scanner + lifecycle management (was 5/14, now 7/14) - .NET: Kill switch + lifecycle management (was 8/14, now 10/14) - Rust: Execution rings + lifecycle management (was 6/14, now 8/14) - Go: MCP security + rings + lifecycle (was 4/14, now 7/14) All SDKs now have lifecycle management. Core governance (policy, identity, trust, audit) + lifecycle = 5 primitives shared across all 5 languages. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: add LIMITATIONS.md - honest design boundaries and layered defense (#953) Addresses valid external critique of AGT's architectural blind spots: 1. Action vs Intent: AGT governs individual actions, not reasoning or action sequences. Documents the compound-action gap explicitly and recommends content policies + model safety layers. 2. Audit logs record attempts, not outcomes: Documents that post-action state verification is the user's responsibility today, with hooks planned. 3. Performance honesty: README now notes that <0.1ms is policy-eval only; distributed mesh adds 5-50ms. Full breakdown in LIMITATIONS.md. 4. Complexity spectrum: Documents the minimal path (just PolicyEvaluator, no mesh/crypto) vs full enterprise stack. 5. Vendor independence: Documents zero cloud dependencies in core, standard formats for all state, migration path. 6. Recommended layered defense architecture diagram showing AGT as one layer alongside model safety, application logic, and infrastructure. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(docs): rewrite OpenClaw sidecar deployment with working K8s manifests (#954) Closes #952 Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat: reversibility checker, trust calibration guide, escalation tests (#955) ReversibilityChecker with 4 levels and compensation plans. Trust score calibration guide with weights, decay, thresholds. 19 tests. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat: AGT Lite — zero-config governance in 3 lines + fix broken quickstart (#956) agent_os.lite: govern() factory, sub-ms enforcement, 16 tests. Fixed quickstart that called nonexistent add_rules(). Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix: bump all runtime versions to 3.1.0 and fix CI lint/test failures (#957) - Bump __version__ in 29 Python __init__.py files from 3.0.2 to 3.1.0 - Bump version= in 6 setup.py files from 3.0.2 to 3.1.0 - Bump meter version strings in _mcp_metrics.py - Bump 9 package.json files from 3.0.2 to 3.1.0 - Bump .NET csproj Version from 3.0.2 to 3.1.0 - Bump Rust workspace Cargo.toml from 3.0.2 to 3.1.0 - Create Go sdk doc.go with version marker 3.1.0 - Fix ruff W292 (missing newline at EOF) in data_classification.py - Fix CLI init regex to allow dots in agent names (test_init_special_characters) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(openclaw): critical honesty pass — document what works vs what's planned (#958) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): fix Rust crate packaging - use workspace root with -p agentmesh (#959) * fix(openclaw): critical honesty pass — document what works vs what's planned Server (__main__.py): - Add --host/--port argparse + env var support (was hardcoded 127.0.0.1:8080) Dockerfile.sidecar: - Copy modules/ directory (was missing, causing build failure) - Use 0.0.0.0 for container binding (127.0.0.1 is wrong inside containers) - Remove phantom port 9091 (no separate metrics listener exists) openclaw-sidecar.md — full honesty rewrite: - Add status banner: transparent interception is NOT yet implemented - Document actual sidecar API endpoints (health, detect/injection, execute, metrics) - Fix Docker Compose to use Dockerfile.sidecar (was using wrong Dockerfile) - Remove GOVERNANCE_PROXY claim (OpenClaw doesn't natively read this) - Replace fictional SLO/Grafana sections with real /api/v1/metrics docs - Add Roadmap section listing what's planned vs shipped openshell.md: - Remove references to non-existent shell scripts - Fix python -m agentmesh.server to python -m agent_os.server - Add note that sidecar doesn't transparently intercept (must call API) - Replace pip install agentmesh-platform with Python skill library usage Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): fix Rust crate packaging — use workspace root with -p agentmesh cargo package in a workspace writes .crate files to the workspace root's target/package/, not the individual crate's directory. The pipeline was running from the crate subdirectory and couldn't find the output. Fix: change workingDirectory from packages/agent-mesh/sdks/rust/agentmesh to packages/agent-mesh/sdks/rust (workspace root) and add -p agentmesh to all cargo commands to target the specific crate. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs(adr): ADR 0005 — Liveness attestation extension for TrustHandshake (#948) Proposes liveness attestation as opt-in gate for TrustHandshake. Addresses ghost-agent and ungraceful-handoff gaps from #772. Co-authored-by: kevinkaylie <129134148+kevinkaylie@users.noreply.github.com> * blog: MCP Security — Why Your AI Agent Tool Calls Need a Firewall (#899) Co-authored-by: aymenhmaidiwastaken <63942652+aymenhmaidiwastaken@users.noreply.github.com> * feat: add LotL prevention policy for security measures (#949) YAML policy template for Living-off-the-Land detection and prevention. * feat(examples): add ATR community security rules for PolicyEvaluator (#908) 15 curated ATR detection rules + sync script. Closes #901. * fix(docs): correct npm package name and stale version refs across 21 files (#960) - Fix @agentmesh/sdk → @microsoft/agentmesh-sdk in 13 markdown files (README, QUICKSTART, tutorials, SDK docs, i18n, changelog) - Fix broken demo path in agent-os README (agent-os/demo.py → demo/maf_governance_demo.py) - Remove stale v1.0.0 labels from extension status table - Bump AGT Version refs 3.0.2 → 3.1.0 in case study templates and ATF conformance assessment Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): use ESRP Release for NuGet signing (#961) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): correct ESRP NuGet contenttype casing (#962) * fix(ci): add missing packages to ESRP pipeline and fix Go version tag Three gaps found during publish verification: 1. PyPI: add agentmesh-marketplace (8th package, was missing from matrix) 2. Rust: build+publish both workspace crates (agentmesh + agentmesh-mcp) - Changed from single-crate to workspace build (--workspace) - Package loop builds both .crate files - Renamed artifact from 'rust-agentmesh' to 'rust-crates' 3. Go: add 'v' prefix to version in doc.go (3.1.0 → v3.1.0) - Go module tags require semver with v prefix - Pipeline grep expects '// Version: v...' format Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): correct ESRP NuGet contenttype casing — 'NuGet' not 'Nuget' ESRP Release rejected 'Nuget' with: 'The value provided for ReleaseContentType property is invalid.' ErrorCode 2254. ESRP content types are case-sensitive. Fix: 'Nuget' -> 'NuGet'. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): add missing packages to ESRP pipeline and fix Go version tag (#963) * fix(ci): add missing packages to ESRP pipeline and fix Go version tag Three gaps found during publish verification: 1. PyPI: add agentmesh-marketplace (8th package, was missing from matrix) 2. Rust: build+publish both workspace crates (agentmesh + agentmesh-mcp) - Changed from single-crate to workspace build (--workspace) - Package loop builds both .crate files - Renamed artifact from 'rust-agentmesh' to 'rust-crates' 3. Go: add 'v' prefix to version in doc.go (3.1.0 → v3.1.0) - Go module tags require semver with v prefix - Pipeline grep expects '// Version: v...' format Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): correct ESRP NuGet contenttype casing — 'NuGet' not 'Nuget' ESRP Release rejected 'Nuget' with: 'The value provided for ReleaseContentType property is invalid.' ErrorCode 2254. ESRP content types are case-sensitive. Fix: 'Nuget' -> 'NuGet'. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): use EsrpCodeSigning + dotnet push for NuGet (#965) EsrpRelease@11 does not support NuGet as a contenttype — it's for PyPI/npm/Maven/crates.io package distribution. NuGet packages must be signed with EsrpCodeSigning@5 first, then pushed with dotnet nuget push. New flow: 1. EsrpCodeSigning@5 with NuGetSign + NuGetVerify operations (CP-401405) 2. dotnet nuget push with the signed .nupkg to nuget.org This matches the standard Microsoft NuGet ESRP signing pattern used by azure-sdk, dotnet runtime, and other Microsoft OSS projects. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(security): upgrade axios to 1.15.0 - CVE-2026-40175, CVE-2025-62718 (#966) Critical S360 action items for SFI-ES5.2 1ES Open Source Vulnerabilities. CVE-2026-40175 (CVSS 9.9): Unrestricted Cloud Metadata Exfiltration via Header Injection Chain — prototype pollution gadget enables CRLF injection in HTTP headers, bypassing AWS IMDSv2 session tokens. CVE-2025-62718: NO_PROXY Bypass via Hostname Normalization — trailing dots and IPv6 literals skip NO_PROXY matching, enabling SSRF through attacker-controlled proxy. Upgraded in 3 packages: - extensions/copilot: 1.14.0 → 1.15.0 - extensions/cursor: 1.13.5 → 1.15.0 - agent-os-vscode: 1.13.6 → 1.15.0 Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): resolve ESRP_DOMAIN_TENANT_ID cyclical reference (#967) The ADO variable ESRP_DOMAIN_TENANT_ID had a cyclical self-reference, preventing ESRP authentication across ALL publishing stages (PyPI, npm, NuGet, crates.io). Fix: Define MICROSOFT_TENANT_ID as a pipeline-level variable with the well-known Microsoft corporate tenant ID (72f988bf-..., same default used by ESRP Release action.yml). This is a public value, not a secret. Also: NuGet publishing requires Microsoft as co-owner of the package on NuGet.org. See https://aka.ms/Microsoft-NuGet-Compliance Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: sync audit redaction status and framing with current code - Update SOC2 mapping to reflect CredentialRedactor now redacts credential-like secrets before audit persistence (API keys, tokens, JWTs, connection strings, etc.). Remaining gap: non-credential PII (email, phone, addresses) not yet redacted in audit entries. - Replace 'kernel-level enforcement' with 'policy-layer enforcement' in README, OWASP compliance, and architecture overview to match the existing 'application-level governance' framing in README Security section and LIMITATIONS.md. - Qualify 10/10 OWASP coverage claim in COMPARISON.md with footnote clarifying this means mitigation components exist per risk category, not full elimination. - Update owasp-llm-top10-mapping.md LLM06 row for credential redaction. Addresses doc/code inconsistencies identified in external review. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Co-authored-by: kevinkaylie <129134148+kevinkaylie@users.noreply.github.com> Co-authored-by: Aymen Hmaidi <63942652+aymenhmaidiwastaken@users.noreply.github.com> Co-authored-by: harshnair75567-cloud <harshnair75567@gmail.com> Co-authored-by: Adamthereal <imadam4real@gmail.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Co-authored-by: kevinkaylie <129134148+kevinkaylie@users.noreply.github.com> Co-authored-by: Aymen Hmaidi <63942652+aymenhmaidiwastaken@users.noreply.github.com> Co-authored-by: harshnair75567-cloud <harshnair75567@gmail.com> Co-authored-by: Adamthereal <imadam4real@gmail.com> * fix(lint): resolve agent-mesh lint errors in eu_ai_act.py (#1028) - Remove unused variable profiling_override (F841) - Remove f-string without placeholders (F541) - Fix whitespace in docstrings (W293) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): add path filters and concurrency; announce v3.1.0 release (#1039) CI optimization: - Add paths-ignore for docs to 5 code-only workflows - Add paths filter to Link Check (only run on docs changes) - Add concurrency groups to 7 heavy workflows - Docs-only PRs drop from ~14 checks to ~4 README: - Add v3.1.0 release announcement callout - Add PyPI version badge - Update tutorial count to 31 Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: add ADOPTERS.md and make deployment guides multi-cloud (#1040) - New ADOPTERS.md following Backstage/Flatcar pattern with Production, Evaluation, and Academic tables + instructions for adding your org - Rewrite docs/deployment/README.md from Azure-only to multi-cloud: Azure (AKS, Foundry, Container Apps), AWS (ECS/Fargate), GCP (GKE), Docker Compose, self-hosted. Updated architecture diagram to show cloud-agnostic deployment patterns. - Fix broken AWS/GCP links (pointed to non-existent paths) - README now links to 'Deployment Guides' (multi-cloud) instead of 'Azure Deployment' - README Contributing section invites adopters to add their org Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat: add AGT Lite — zero-config governance in 3 lines, fix broken quickstart (#1044) Addresses the #1 developer experience criticism: AGT is too complex to start. New: agent_os.lite — lightweight governance module - govern() factory: one line to create a governance gate - check(action): one line to enforce — raises GovernanceViolation or returns True - check.is_allowed(action): non-raising bool version - Allow lists, deny lists, regex patterns, content filtering, rate limiting - Built-in audit trail and stats - Sub-millisecond evaluation (0.003ms avg, 1000 evals in <100ms) - Zero dependencies beyond stdlib (re, time, datetime) - 16 tests passing Fix: govern_in_60_seconds.py quickstart - BROKEN: was calling PolicyEvaluator.add_rules() which does not exist - FIXED: now uses agent_os.lite.govern() which actually works - Verified end-to-end: script runs and produces correct output The lite module is for developers who just want basic governance without learning PolicyEvaluator, YAML, OPA/Rego, trust mesh, etc. Upgrade to the full stack when you need it. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(ci): enhance weekly security audit with 7 new scan jobs (#1051) Add comprehensive security checks based on issues found during the MSRC-111178 security audit and ongoing post-merge reviews: - Workflow security regression (MSRC-111178 pull_request_target check) - Expression injection scan (github.event.* in run: blocks) - Docker security (root containers, wildcard CORS, hardcoded passwords, 0.0.0.0 bindings) - XSS and unsafe DOM (innerHTML, eval, yaml.load, shell=True) - Action SHA pinning compliance - Version pinning (pyproject.toml upper bounds, Docker :latest tags, license field format) - Dependency confusion with --strict mode (pyproject.toml + package.json) - Retention days updated to 180 (EU AI Act Art. 26(6)) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): fix OpenShell integration CI — spelling, link check, policy validation (#1057) - Add OpenShell/NVIDIA terms to cspell dictionary (Landlock, seccomp, syscall, etc.) - Fix broken link: openclaw-skill -> openshell-skill in docs/integrations/openshell.md - Fix policy validation: replace starts_with (invalid) with matches + regex Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat: add reversibility checker, trust calibration guide, and escalation/reversibility tests (#1061) Addresses critical review feedback: 1. Rollback/reversibility (agent_os.reversibility) - ReversibilityChecker: pre-execution assessment of action reversibility - 4 levels: fully_reversible, partially_reversible, irreversible, unknown - CompensatingAction: structured undo plans for each action type - Built-in rules for 12 common actions (write, deploy, delete, email, etc.) - block_irreversible mode for strict environments 2. Trust score calibration guide (docs/security/trust-score-calibration.md) - Score component weights (compliance 35%, task 25%, behavior 25%, identity 15%) - Decay functions with tier floors - Initial score assignments by agent origin - Threshold recommendations (conservative/moderate/permissive) - Anti-gaming measures and operational playbook 3. Tests: 19 passing (10 escalation + 9 reversibility) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat: deployment runtime (Docker/AKS) and shared trust core types (#1062) agent-runtime: Evolve from thin re-export shim to deployment runtime - DockerDeployer: container deployment with security hardening (cap-drop ALL, no-new-privileges, read-only rootfs) - KubernetesDeployer: AKS pod deployment with governance sidecars (runAsNonRoot, seccompProfile, resource limits) - GovernanceConfig: policy/trust/audit config injected as env vars - DeploymentTarget protocol for extensibility (ADC, nono, etc.) - 24 tests (all subprocess calls mocked) agent-mesh: Extract shared trust types into agentmesh.trust_types - TrustScore, AgentProfile, TrustRecord, TrustTracker - Canonical implementations replacing ~800 lines of duplicated code across 6+ integration packages - 25 tests covering clamping, scoring, history, capabilities Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(dotnet): add kill switch and lifecycle management to .NET SDK (#1065) - Add KillSwitch with arm/disarm, event history, and subscriber notifications - Add LifecycleManager with 8-state machine and validated transitions - Add comprehensive xUnit tests for both components (26 tests) - Update .NET SDK README with usage documentation Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(go): add MCP security, execution rings, and lifecycle management to Go SDK (#1066) - mcp.go: MCP security scanner detecting tool poisoning, typosquatting, hidden instructions (zero-width chars, homoglyphs), and rug pulls - rings.go: Execution privilege ring model (Admin/Standard/Restricted/Sandboxed) with default-deny access control - lifecycle.go: Eight-state agent lifecycle manager with validated transitions - Full test coverage for all three modules - Updated README with API docs and examples Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(rust): add execution rings and lifecycle management to Rust SDK (#1067) * feat(dotnet): add kill switch and lifecycle management to .NET SDK - Add KillSwitch with arm/disarm, event history, and subscriber notifications - Add LifecycleManager with 8-state machine and validated transitions - Add comprehensive xUnit tests for both components (26 tests) - Update .NET SDK README with usage documentation Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * feat(rust): add execution rings and lifecycle management to Rust SDK Add two new modules to the agentmesh Rust crate: - rings.rs: Four-level execution privilege ring model (Admin/Standard/ Restricted/Sandboxed) with per-agent assignment and per-ring action permissions, ported from the Python hypervisor enforcer. - lifecycle.rs: Eight-state agent lifecycle manager (Provisioning through Decommissioned) with validated state transitions and event history, matching the lifecycle model used across other SDK languages. Both modules include comprehensive unit tests and are re-exported from the crate root. README updated with API tables and usage examples. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix: align lotl_prevention_policy.yaml with PolicyDocument schema The policy file used an incompatible schema format (id, parameter, regex_match, effect) instead of the expected PolicyDocument fields (name, condition.field, operator, action). This caused the validate-policies CI check to fail for all PRs. Changes: - id → name - condition.parameter → condition.field - operator: regex_match → operator: matches - action at rule level (shell_exec/file_read) → action: deny - effect: DENY → removed (redundant with action: deny) - Added version, name, description, disclaimer at top level Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix: resolve .NET ESRP signing issues blocking NuGet publish GitHub Actions (publish.yml): - Fix broken if-guards on signing steps: env.ESRP_AAD_ID was set in step-level env (invisible to if-expressions). Replace with job-level ESRP_CONFIGURED env derived from secrets. - Add missing ESRP_CERT_IDENTIFIER to signing step env blocks. - Gate the publish step on ESRP_CONFIGURED so unsigned packages are never pushed to NuGet.org under the Microsoft.* prefix. - Make stub signing steps fail-fast (exit 1) instead of silently succeeding, preventing unsigned packages from reaching NuGet push. ADO Pipeline (esrp-publish.yml): - Add UseDotNet@2 task to Publish_NuGet stage so dotnet nuget push has a guaranteed SDK version on the Windows agent. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(docs): fix OpenClaw sidecar demo and add limitations callout (#1163) The docker-compose example in openclaw-sidecar.md was illustrative only and did not work — it referenced a non-existent OpenClaw image and lacked healthchecks. Users were hitting this and getting confused. Changes: - Add working demo at demo/openclaw-governed/ with docker-compose.yaml that builds and runs the governance sidecar from source - Replace the inline docker-compose in the doc with a link to the demo plus a clearly-labeled reference template for custom deployments - Add prominent WARNING callout listing known limitations (no native OpenClaw integration, no published images, explicit API required) - Remove stale orphaned curl snippet after the docker-compose block - Add healthcheck to docker-compose governance-sidecar service - Fix OpenClaw image reference from ghcr.io/openclaw/openclaw:latest to a placeholder users must replace with their own image Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(docs): fix OpenClaw sidecar demo and add limitations callout (#1164) The docker-compose example in openclaw-sidecar.md was illustrative only and did not work — it referenced a non-existent OpenClaw image and lacked healthchecks. Users were hitting this and getting confused. Changes: - Add working demo at demo/openclaw-governed/ with docker-compose.yaml that builds and runs the governance sidecar from source - Replace the inline docker-compose in the doc with a link to the demo plus a clearly-labeled reference template for custom deployments - Add prominent WARNING callout listing known limitations (no native OpenClaw integration, no published images, explicit API required) - Remove stale orphaned curl snippet after the docker-compose block - Add healthcheck to docker-compose governance-sidecar service - Fix OpenClaw image reference from ghcr.io/openclaw/openclaw:latest to a placeholder users must replace with their own image Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix(ci): use PME tenant ID for ESRP cert signing The ESRP signing cert lives in the PME (Partner Managed Engineering) tenant (975f013f), not the Microsoft corporate tenant (72f988bf). Using the wrong tenant ID causes ESRP signing to fail when looking up the cert. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: Add Scaling AI Agents article to COMMUNITY.md (#857) Co-authored-by: deepsearch <deepsearch@deepsearchdeMac-mini.local> * Add runtime evidence mode to agt verify (#969) * Track agt verify evidence plan * Add runtime evidence mode to agt verify * Add runtime evidence verifier tests * Add CLI tests for agt verify evidence mode * Document evidence mode for compliance verification * Remove local implementation notes * Document agt verify evidence mode * Harden evidence path handling in verify --------- Co-authored-by: T. Smith <smith@antiparty.co> * docs: add Entra Agent ID bridge tutorial with R&R matrix and DID fix - Add Tutorial 31: Bridging AGT Identity with Microsoft Entra Agent ID - Detailed roles & responsibilities between AGT and Entra/Agent365 - Architecture diagram showing the identity bridge - Step-by-step: DID creation, Entra binding, AKS workload identity, token validation, lifecycle sync, access verification - Known gaps and limitations table - Platform independence note (AWS, GCP, Okta patterns) - Fix DID prefix in .NET MCP gateway tests (did:agentmesh → did:mesh for consistency with Python reference implementation and .NET SDK) - Update tutorials README with Enterprise Identity section Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Co-authored-by: kevinkaylie <129134148+kevinkaylie@users.noreply.github.com> Co-authored-by: Aymen Hmaidi <63942652+aymenhmaidiwastaken@users.noreply.github.com> Co-authored-by: harshnair75567-cloud <harshnair75567@gmail.com> Co-authored-by: Adamthereal <imadam4real@gmail.com> Co-authored-by: Jack Batzner <jackbatzner@microsoft.com> Co-authored-by: lawcontinue <134219708+lawcontinue@users.noreply.github.com> Co-authored-by: deepsearch <deepsearch@deepsearchdeMac-mini.local> Co-authored-by: ewmh <tionne@gmail.com> Co-authored-by: T. Smith <smith@antiparty.co> * docs: address external critic gaps in limitations and threat model (#11) Add three new sections to LIMITATIONS.md addressing gaps identified in public criticism and external security analysis: - §10 Physical AI and Embodied Agent Governance: documents that AGT governs software agents not physical actuators, with mitigations - §11 Streaming Data and Real-Time Assurance: documents that AGT evaluates per-action not continuously over data streams - §12 DID Method Inconsistency Across SDKs: documents the did:mesh vs did:agentmesh split with migration plan for v4.0 Update THREAT_MODEL.md residual risks to reference all three new limitation sections. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * fix!: standardize DID method to did:agentmesh across all SDKs (#12) * fix!: standardize DID method to did:agentmesh across all SDKs BREAKING CHANGE: All agent DIDs now use the did:agentmesh: prefix. The legacy did:mesh: prefix used by Python and .NET has been migrated to match the did:agentmesh: convention already used by TypeScript, Rust, and Go SDKs. Changes: - Python: agent_id.py, delegation.py, entra.py, all integrations - .NET: AgentIdentity.cs, Jwk.cs, GovernanceKernel.cs, all tests - Docs: README, tutorials, identity docs, FAQ, compliance docs - Tests: all test fixtures updated across Python, .NET, TS, VSCode - Version bump: 3.1.0 → 3.2.0 (.NET, Python agent-mesh, TypeScript) Migration: replace did:mesh: with did:agentmesh: in your policies, identity registries, and agent configurations. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> * docs: add Q11-Q13 to FAQ — AGT scope, Agent 365, and DLP comparison Adds three new customer Q&As: - Q11: Is AGT for Foundry agents or any agent type? (any) - Q12: Relationship between AGT and Agent 365 (different layers) - Q13: How is AGT different from DLP/communication compliance (content vs action governance) Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> --------- Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Co-authored-by: kevinkaylie <129134148+kevinkaylie@users.noreply.github.com> Co-authored-by: Aymen Hmaidi <63942652+aymenhmaidiwastaken@users.noreply.github.com> Co-authored-by: harshnair75567-cloud <harshnair75567@gmail.com> Co-authored-by: Adamthereal <imadam4real@gmail.com> Co-authored-by: Jack Batzner <jackbatzner@microsoft.com> Co-authored-by: lawcontinue <134219708+lawcontinue@users.noreply.github.com> Co-authored-by: deepsearch <deepsearch@deepsearchdeMac-mini.local> Co-authored-by: ewmh <tionne@gmail.com> Co-authored-by: T. Smith <smith@antiparty.co>
1 parent 0de1d51 commit 6e3934b

2 files changed

Lines changed: 98 additions & 0 deletions

File tree

docs/LIMITATIONS.md

Lines changed: 89 additions & 0 deletions
Original file line numberDiff line numberDiff line change
@@ -244,6 +244,95 @@ dashboard shows "governed" status, but no rules are enforced.
244244

245245
> *This risk was identified in external red-team analysis by [Periculo](https://www.periculo.co.uk/cyber-security-blog/red-teaming-the-microsoft-agent-governance-toolkit-15-bypass-vectors).*
246246
247+
## 10. Physical AI and Embodied Agent Governance
248+
249+
AGT governs **software agents** that call tools via APIs, MCP, or inter-agent
250+
protocols. It does **not** provide governance primitives specific to **physical
251+
agents** (robots, drones, autonomous vehicles, industrial actuators).
252+
253+
**What this means in practice:**
254+
255+
- ✅ AGT can govern the *software decision layer* of a robotic agent (e.g.,
256+
blocking an API call to arm a mechanism)
257+
- ❌ AGT does **not** provide hardware kill switches, force-limiting, or actuator
258+
safety interlocks
259+
- ❌ AGT does **not** model physical world state, collision boundaries, or
260+
safety zones
261+
- ❌ AGT does **not** address latency requirements for real-time control loops
262+
(typically <10ms) — policy evaluation at <0.1ms is fast enough, but the
263+
full governance stack (identity, trust, audit) may not be
264+
265+
**Example gap:** A warehouse robot governed by AGT has its `move_to_location`
266+
call approved by policy, but the target location is occupied by a human. AGT
267+
has no spatial awareness to detect this.
268+
269+
**Mitigations available today:**
270+
- Use AGT's policy engine for the *decision layer* — blocking unsafe commands
271+
before they reach the actuator layer
272+
- Combine AGT with domain-specific robot safety frameworks (e.g., ROS 2 Safety
273+
Controller, ISO 10218 / ISO 15066 compliance layers)
274+
- Use **execution rings** to isolate physical actuator calls in Ring 0 with
275+
human-in-the-loop approval
276+
277+
**Status:** Physical AI governance is out of scope for AGT's current roadmap.
278+
We welcome community contributions exploring this space.
279+
280+
## 11. Streaming Data and Real-Time Assurance
281+
282+
AGT evaluates policies **per-action at invocation time**. It does not provide
283+
continuous assurance over **streaming data**, real-time sensor feeds, or
284+
long-running data pipelines.
285+
286+
**What this means in practice:**
287+
288+
- ✅ AGT can govern an agent's decision to *subscribe* to a data stream
289+
- ❌ AGT does **not** inspect individual messages within an active stream
290+
- ❌ AGT does **not** guarantee data freshness, completeness, or consistency
291+
in streaming contexts
292+
- ❌ AGT does **not** detect stale or poisoned data arriving via a governed
293+
stream after the initial subscription was approved
294+
295+
**Example gap:** An agent subscribes to a real-time market data feed (permitted
296+
by policy). The feed starts returning stale data due to an upstream outage.
297+
AGT logs the subscription as approved but has no visibility into data quality
298+
degradation.
299+
300+
**Mitigations available today:**
301+
- Use **SRE SLOs** to monitor data freshness and error rates at the stream level
302+
- Use **circuit breakers** to halt agent actions when upstream data quality
303+
degrades
304+
- Implement application-level stream validation in your agent code
305+
306+
## 12. DID Method Inconsistency Across SDKs
307+
308+
AGT uses two DID (Decentralized Identifier) method prefixes across its SDKs:
309+
310+
| SDK | DID Format | Example |
311+
|-----|-----------|---------|
312+
| Python | `did:mesh:*` | `did:mesh:a7f3b2c1...` |
313+
| .NET | `did:mesh:*` | `did:mesh:a7f3b2c1...` |
314+
| TypeScript | `did:agentmesh:*` | `did:agentmesh:analyst:abc123` |
315+
| Rust | `did:agentmesh:*` | `did:agentmesh:agent_id` |
316+
| Go | `did:agentmesh:*` | `did:agentmesh:agent_id` |
317+
318+
**What this means in practice:**
319+
320+
- Both formats use the same cryptographic primitives (Ed25519) and are
321+
functionally equivalent
322+
- Cross-SDK agent interactions work if both sides parse the DID correctly
323+
- Policy rules that match on DID prefix (e.g., `did:mesh:*`) will not match
324+
agents using `did:agentmesh:*` and vice versa
325+
326+
**Mitigations available today:**
327+
- Use wildcard DID matching in policies (e.g., `did:*`) to match both formats
328+
- Normalize DIDs at your application boundary before passing to the policy engine
329+
- When building cross-SDK systems, use the same SDK family for identity
330+
generation
331+
332+
**What we're building:**
333+
- DID method standardization to `did:agentmesh:*` across all SDKs (planned for v4.0)
334+
- Migration tooling to update existing identity registries
335+
247336
---
248337

249338
*This document is maintained alongside the codebase. If you find a limitation

docs/THREAT_MODEL.md

Lines changed: 9 additions & 0 deletions
Original file line numberDiff line numberDiff line change
@@ -182,6 +182,15 @@ AGT reduces risk but does not eliminate it. The main residual risks are:
182182
hold across tasks within a session — accumulated permissions may exceed
183183
what the current task requires — see
184184
[Limitations §8](LIMITATIONS.md#8-credential-persistence-gap)
185+
- **Physical AI scope**: AGT governs software agents, not physical actuators,
186+
hardware interlocks, or real-time control loops — see
187+
[Limitations §10](LIMITATIONS.md#10-physical-ai-and-embodied-agent-governance)
188+
- **Streaming data**: AGT evaluates policies per-action, not continuously over
189+
data streams — data freshness and quality are not assured — see
190+
[Limitations §11](LIMITATIONS.md#11-streaming-data-and-real-time-assurance)
191+
- **DID method inconsistency**: Python/.NET use `did:mesh:*` while TS/Rust/Go
192+
use `did:agentmesh:*` — cross-SDK policy rules must account for both — see
193+
[Limitations §12](LIMITATIONS.md#12-did-method-inconsistency-across-sdks)
185194

186195
## Configuration Bypass Vectors
187196

0 commit comments

Comments
 (0)